Structure of PDB 6zu1 Chain AE

Receptor sequence

>6zu1AE (length=156) Species: 562 (Escherichia coli) [Search protein sequence]

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPAMVAAKRGK
SVEEIL

3D structure

PDB

6zu1 Structural basis of transcription-translation coupling and collision in bacteria.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	N19 V21 S22 K23 T24 V25 K26 R29 Y50 K52 K62 H89 T90 F95 A99 S100 T103 A107 G108 L124 A125 K126 Y128 S130 T131 N132 N135	N10 V12 S13 K14 T15 V16 K17 R20 Y41 K43 K53 H80 T81 F86 A90 S91 T94 A98 G99 L115 A116 K117 Y119 S121 T122 N123 N126
BS02	rna	AE	L15 R20 F31 F33 V56 I60	L6 R11 F22 F24 V47 I51

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zu1, PDBe:6zu1, PDBj:6zu1
PDBsum	6zu1
PubMed	32820062
UniProt	P0A7W1\|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]