Structure of PDB 6olz Chain AE

Receptor sequence

>6olzAE (length=226) Species: 9606 (Homo sapiens)

PHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYPVGGDKNGGTRVVKLRKM
PRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRV
VFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNVKIPKHL
TDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIK
AIPQLQGYLRSVFALTNGIYPHKLVF

3D structure

• PDB: 6olz Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.
• Chain: AE
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	P42 H43 C44 S45 R46 R52 S58 R59 S60 Y63 S64 R65 K66 A67 Y69 K70 R71 K72 Y73 P95 K100 G102 R105 K108 R110 K111 P113 R114 Y115 R123 K124 L125 L126 H128 K130 P132 F133 S134 H136 V137 T154 R156 R158 L172 L179 V180 L181 R183 P185 R187 R188 H190 F217 K219 R226 H227 Q228 E229 F233 E236 K239 Y240 R246 K247 Q250 K262 P265 Q266 R272 S273 V274 T278 N279	P1 H2 C3 S4 R5 R11 S17 R18 S19 Y22 S23 R24 K25 A26 Y28 K29 R30 K31 Y32 P33 K38 G40 R43 K46 R48 K49 P51 R52 Y53 R61 K62 L63 L64 H66 K68 P70 F71 S72 H74 V75 T92 R94 R96 L110 L117 V118 L119 R121 P123 R125 R126 H128 F155 K157 R164 H165 Q166 E167 F171 E174 K177 Y178 R184 K185 Q188 K200 P203 Q204 R210 S211 V212 T216 N217

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6olz, PDBe:6olz, PDBj:6olz
• PDBsum: 6olz
• PubMed: 31160784
• UniProt: Q02878|RL6_HUMAN Large ribosomal subunit protein eL6 (Gene Name=RPL6)