Structure of PDB 5j4z Chain AE

Receptor sequence
>5j4zAE (length=196) Species: 9940 (Ovis aries) [Search protein sequence]
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLITATTTVGVAYA
AKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRH
RTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANA
GDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
3D structure
PDB5j4z The architecture of respiratory supercomplexes.
ChainAE
Resolution5.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES AE H141 L142 C144 C158 C160 H161 S163 H141 L142 C144 C158 C160 H161 S163
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 18:37:15 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5j4z', asym_id = 'AE', title = 'The architecture of respiratory supercomplexes.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5j4z', asym_id='AE', title='The architecture of respiratory supercomplexes.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0008121,0016020,0051537', uniprot = '', pdbid = '5j4z', asym_id = 'AE'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008121,0016020,0051537', uniprot='', pdbid='5j4z', asym_id='AE')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>