Structure of PDB 5a9z Chain AE

Receptor sequence

>5a9zAE (length=206) Species: 300852 (Thermus thermophilus HB8)

MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLG
FLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGE
RVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRV
YKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRE
TKKAAK

3D structure

• PDB: 5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
• Chain: AE
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	G10 M11 T12 R19 V21 R36 E40 K41 V47 P56 K57 V59 N60 R61 K64 G65 L78 R79 I81 K109 G110 R111 F113 A114 G115 M117 W120 N121 F122 A123 D127 S128 H129 A131 H132 K133 I134 H135 R136 P138 G139 S140 I141 G142 N143 R144 K145 T146 R149 V150 Y151 K152 G153 M156 H159 Y160 A162 R164 V165 T166 M168 N169 K185 A187 V188 G190 P191 N192 K203 A204 A205 K206	G10 M11 T12 R19 V21 R36 E40 K41 V47 P56 K57 V59 N60 R61 K64 G65 L78 R79 I81 K109 G110 R111 F113 A114 G115 M117 W120 N121 F122 A123 D127 S128 H129 A131 H132 K133 I134 H135 R136 P138 G139 S140 I141 G142 N143 R144 K145 T146 R149 V150 Y151 K152 G153 M156 H159 Y160 A162 R164 V165 T166 M168 N169 K185 A187 V188 G190 P191 N192 K203 A204 A205 K206

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
• PDBsum: 5a9z
• PubMed: 26283392
• UniProt: Q5SHN8|RL3_THET8 Large ribosomal subunit protein uL3 (Gene Name=rplC)