Structure of PDB 4v6o Chain AE

Receptor sequence

>4v6oAE (length=240) Species: 562 (Escherichia coli) [Search protein sequence]

ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFN
EALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGML
TNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGI
KDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIP
GNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE

3D structure

PDB

4v6o Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

14.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	R20 Y21 W22 P24 K25 K27 A33 N35 K36 H93 R94 L96 G97 G98 M99 T101 N102 K104 T105 S109 R112 T129 K130 K131 E132 L134 M135 R138 E139 E141 K142 N145 S146 I170 E174	R20 Y21 W22 P24 K25 K27 A33 N35 K36 H93 R94 L96 G97 G98 M99 T101 N102 K104 T105 S109 R112 T129 K130 K131 E132 L134 M135 R138 E139 E141 K142 N145 S146 I170 E174
BS02	rna	AE	K104 L178	K104 L178

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008270	zinc ion binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
PDBsum	4v6o
PubMed	22467828
UniProt	P0A7V0\|RS2_ECOLI Small ribosomal subunit protein uS2 (Gene Name=rpsB)

[Back to BioLiP]