Structure of PDB 4v6c Chain AE

Receptor sequence

>4v6cAE (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK

3D structure

PDB

4v6c Structures of the ribosome in intermediate States of ratcheting.

Chain

Resolution

3.19 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	V20 S21 K22 T23 K25 G26 R28 Y49 K51 K61 H88 T89 Q96 A98 S99 G101 I105 A106 G107 R111 L123 A124 K125 A126 Y127 S129 T130 N131 N134	V12 S13 K14 T15 K17 G18 R20 Y41 K43 K53 H80 T81 Q88 A90 S91 G93 I97 A98 G99 R103 L115 A116 K117 A118 Y119 S121 T122 N123 N126

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v6c, PDBe:4v6c, PDBj:4v6c
PDBsum	4v6c
PubMed	19696352
UniProt	P0A7W1\|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]