Structure of PDB 4v5k Chain AE

Receptor sequence
>4v5kAE (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
3D structure
PDB4v5k Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.
ChainAE
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AE R14 T16 A17 R18 M19 Q20 A21 G22 R24 K47 P49 K57 Y61 G85 A86 A94 I101 A102 L119 T120 K121 E122 S125 R126 N127 N130 R10 T12 A13 R14 M15 Q16 A17 G18 R20 K43 P45 K53 Y57 G81 A82 A90 I97 A98 L115 T116 K117 E118 S121 R122 N123 N126
BS02 rna AE R15 F28 R11 F24
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v5k, PDBe:4v5k, PDBj:4v5k
PDBsum4v5k
PubMed20852642
UniProtQ5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]