Structure of PDB 4v4g Chain AE

Receptor sequence

>4v4gAE (length=150) Species: 562 (Escherichia coli)

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG

3D structure

• PDB: 4v4g Structural basis for the control of translation initiation during stress.
• Chain: AE
• Resolution: 11.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	R14 R15 T16 A17 R18 M19 Q20 A21 G22 R24 R25 F26 R27 F28 F45 K47 Y60 E83 G85 A86 K88 A95 A102 G103 A104 R107 L119 T120 K121 E122 L123 G124 S125 R126 N127 P128 N130	R10 R11 T12 A13 R14 M15 Q16 A17 G18 R20 R21 F22 R23 F24 F41 K43 Y56 E79 G81 A82 K84 A91 A98 G99 A100 R103 L115 T116 K117 E118 L119 G120 S121 R122 N123 P124 N126

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 17:39:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'AE', title = 'Structural basis for the control of translation initiation during stress.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='AE', title='Structural basis for the control of translation initiation during stress.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v4g', asym_id = 'AE'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='4v4g', asym_id='AE')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>