Structure of PDB 4v4a Chain AE

Receptor sequence

>4v4aAE (length=150) Species: 562 (Escherichia coli)

DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG

3D structure

• PDB: 4v4a X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli
• Chain: AE
• Resolution: 9.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	R14 T16 A17 R18 M19 Q20 A21 R24 R25 R27 K47 K92 P93 A94 A95 T98 A102 G103 R107 L119 T120 K121 E122 L123 R126	R10 T12 A13 R14 M15 Q16 A17 R20 R21 R23 K43 K88 P89 A90 A91 T94 A98 G99 R103 L115 T116 K117 E118 L119 R122

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 01:44:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4a', asym_id = 'AE', title = 'X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4a', asym_id='AE', title='X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v4a', asym_id = 'AE'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='4v4a', asym_id='AE')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>