Structure of PDB 4bts Chain AE

Receptor sequence

>4btsAE (length=229) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

KNDWQPQTKLGRLVKYGKISSLDEIFKYSIPIKEPEIIDHFYPKNKDVQA
EHKLMEEVLQITPVQKQTQAGQRTRFKGFVVVGDSNGHIGLGWKVAKEVQ
GAIKGAITHAKLNMVPVRKGYWGNKIANAHTIPQKITGKSGSVRIRLVPA
PRGTGIVAAPIPKKVLQFAGVQDIYTSSQGCTRTRGNFLKATYYALANTY
RYLTPDFWGKPEDNELPFETFSEFLHTKA

3D structure

PDB

4bts The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.

Chain

Resolution

3.703 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AE	V87 Q88 K89 Q90 Q92 R96 K100 K117 T160 G164 S165 R167 R169 V180 A181 A182 K186 Y198 T199 S201 Q202 C204 T205 R206 T207 N210 K213	V64 Q65 K66 Q67 Q69 R73 K77 K94 T137 G141 S142 R144 R146 V157 A158 A159 K163 Y175 T176 S178 Q179 C181 T182 R183 T184 N187 K190

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4bts, PDBe:4bts, PDBj:4bts
PDBsum	4bts
PubMed	23851459
UniProt	E6PBS0

[Back to BioLiP]