Structure of PDB 8c3a Chain AD

Receptor sequence
>8c3aAD (length=96) Species: 5476 (Candida albicans) [Search protein sequence]
NINSKLALTIKSGKYTLGYKSVVKSLRTGKAKLVIIAANTPVLRKSELEY
YAMLSKTPVYYFQGGNNELGTVCGKLFRVGTLSILDAGDSDILSSI
3D structure
PDB8c3a New crystal system to promote screening for new eukaryotic inhibitors
ChainAD
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AD L27 G28 Y29 K30 S31 N49 P51 V52 L53 R54 K55 S56 E59 L86 F87 R88 V89 G90 L17 G18 Y19 K20 S21 N39 P41 V42 L43 R44 K45 S46 E49 L76 F77 R78 V79 G80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0030627 pre-mRNA 5'-splice site binding
Biological Process
GO:0006364 rRNA processing
GO:0048025 negative regulation of mRNA splicing, via spliceosome
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum8c3a
PubMed
UniProtA0A1D8PM75|RL30_CANAL Large ribosomal subunit protein eL30 (Gene Name=RPL30)

[Back to BioLiP]