Structure of PDB 8apn Chain AD

Receptor sequence

>8apnAD (length=46) Species: 353565 (Polytomella magna)

MKVRGKVKLFCDGCVRTIVRLAKEKHIVLVECSKNPRHKQRSKFAR

3D structure

• PDB: 8apn Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
• Chain: AD
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	R26 H32 K49 F50 R52	R20 H26 K43 F44 R46
BS02	rna	AD	M7 K8 G11 K12 K14 N41 R43 K49	M1 K2 G5 K6 K8 N35 R37 K43
BS03	ZN	AD	C38 H44	C32 H38

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 22:13:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8apn', asym_id = 'AD', title = 'Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8apn', asym_id='AD', title='Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8apn', asym_id = 'AD'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8apn', asym_id='AD')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>