Structure of PDB 7qi4 Chain AD

Receptor sequence

>7qi4AD (length=343) Species: 9606 (Homo sapiens) [Search protein sequence]

SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKV
KRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGR
KKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYED
HTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVS
GSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASP
RGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

PDB

7qi4 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.

Chain

Resolution

2.21 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	T91 L98 K100 G101 A104 T106 G107 A108 G109 K112 R114 R117 T118 K119 R136 R191 S194 G195 N196 R226 V228 F229 T230 M231 T232 A233 K234 E235 R237 R242 F256 K260 D266 R269 R297 F298 K299 R300 R315 C316 H317 R318 Y333 A334 K335 S339 I340 N341 L343 Q347 R351 W408 R419 V421 W422 S423 R427	T4 L11 K13 G14 A17 T19 G20 A21 G22 K25 R27 R30 T31 K32 R49 R104 S107 G108 N109 R139 V141 F142 T143 M144 T145 A146 K147 E148 R150 R155 F169 K173 D179 R182 R210 F211 K212 R213 R228 C229 H230 R231 Y246 A247 K248 S252 I253 N254 L256 Q260 R264 W321 R332 V334 W335 S336 R340
BS02	rna	AD	K112 G113 R128 W179 R189 S197 W198 I201 F229 R237 K239 R264	K25 G26 R41 W92 R102 S110 W111 I114 F142 R150 K152 R177

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qi4, PDBe:7qi4, PDBj:7qi4
PDBsum	7qi4
PubMed	38769321
UniProt	P82675\|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)

[Back to BioLiP]