Structure of PDB 6zm5 Chain AD

Receptor sequence

>6zm5AD (length=343) Species: 9606 (Homo sapiens)

SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKV
KRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGR
KKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYED
HTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVS
GSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASP
RGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

• PDB: 6zm5 Mechanism of membrane-tethered mitochondrial protein synthesis.
• Chain: AD
• Resolution: 2.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	T91 K100 G101 A104 T106 G109 K111 K112 R114 T118 K119 S194 G195 R226 F229 T230 M231 T232 A233 K234 E235 R237 R242 F256 K260 D266 R269 F298 C316 H317 R318 S339 I340 L343 Q347 R351 W408 K418 R419 V421 W422 S423 R427	T4 K13 G14 A17 T19 G22 K24 K25 R27 T31 K32 S107 G108 R139 F142 T143 M144 T145 A146 K147 E148 R150 R155 F169 K173 D179 R182 F211 C229 H230 R231 S252 I253 L256 Q260 R264 W321 K331 R332 V334 W335 S336 R340
BS02	rna	AD	K112 G113 R117 R189 N196 S197 W198 K239 R264	K25 G26 R30 R102 N109 S110 W111 K152 R177

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6zm5, PDBe:6zm5, PDBj:6zm5
• PDBsum: 6zm5
• PubMed: 33602856
• UniProt: P82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)