Structure of PDB 6xyw Chain AD

Receptor sequence

>6xywAD (length=60) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

VKIKFYSSFKDRFKPLNDGTIRRWKEGKRHNAHLKSKKSKRRLRQPGLVP
PAYAKVMKKL

3D structure

PDB

6xyw Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.

Chain

Resolution

3.86 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	V110 K111 I112 K113 Y115 S116 S117 K119 R121 R132 E135 G136 K137 R138 H139 N140 A141 H142 K146 K147 R150 R151 L152 R153 A161 Y162 K164 K167 K168	V1 K2 I3 K4 Y6 S7 S8 K10 R12 R23 E26 G27 K28 R29 H30 N31 A32 H33 K37 K38 R41 R42 L43 R44 A52 Y53 K55 K58 K59

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links