Structure of PDB 6vlz Chain AD

Receptor sequence

>6vlzAD (length=343) Species: 9606 (Homo sapiens)

SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKV
KRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGR
KKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYED
HTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVS
GSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASP
RGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

• PDB: 6vlz Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
• Chain: AD
• Resolution: 2.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	T91 L98 G101 A104 K112 R114 K116 K119 K120 S194 G195 R226 V228 F229 T230 M231 K234 R237 R242 K260 R269 R297 F298 K299 R300 R315 C316 H317 R318 S339 L343 Q347 R351 R355 W408 K412 K418 R419 V421 W422	T4 L11 G14 A17 K25 R27 K29 K32 K33 S107 G108 R139 V141 F142 T143 M144 K147 R150 R155 K173 R182 R210 F211 K212 R213 R228 C229 H230 R231 S252 L256 Q260 R264 R268 W321 K325 K331 R332 V334 W335
BS02	rna	AD	R117 N145 P147 N227 K239 M265	R30 N58 P60 N140 K152 M178

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6vlz, PDBe:6vlz, PDBj:6vlz
• PDBsum: 6vlz
• PubMed: 32737313
• UniProt: P82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)