Structure of PDB 6gqb Chain AD

Receptor sequence

>6gqbAD (length=150) Species: 559292 (Saccharomyces cerevisiae S288C)

GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIG
VLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKH
LERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN

3D structure

• PDB: 6gqb Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: AD
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	R127 K140	R126 K139
BS02	rna	AD	R3 M4 G8 K9 G10 I11 S12 S13 S14 A15 I16 P17 S48 Q49 G51 R55 T61 R64 K70 I71 M72 R73 K76 Y90 K94 S97 V98 H101 R104 D108 K109 D110 K112 F113 R114 S120 R121 R124 Y128	R2 M3 G7 K8 G9 I10 S11 S12 S13 A14 I15 P16 S47 Q48 G50 R54 T60 R63 K69 I70 M71 R72 K75 Y89 K93 S96 V97 H100 R103 D107 K108 D109 K111 F112 R113 S119 R120 R123 Y127

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gqb, PDBe:6gqb, PDBj:6gqb
• PDBsum: 6gqb
• PubMed: 29886014
• UniProt: P05756|RS13_YEAST Small ribosomal subunit protein uS15 (Gene Name=RPS13)