Structure of PDB 4v9k Chain AD

Receptor sequence

>4v9kAD (length=208) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	G2 R3 Y4 P7 V8 R10 R14 K22 R25 R35 R36 P40 G41 Q42 H43 S52 Y54 A55 Q62 E72 R73 Q74 N77 K85 R115 Q116 R118 Q119 R122 H123 H125 R132 D134 L135 S137 Y138 R209	G1 R2 Y3 P6 V7 R9 R13 K21 R24 R34 R35 P39 G40 Q41 H42 S51 Y53 A54 Q61 E71 R72 Q73 N76 K84 R114 Q115 R117 Q118 R121 H122 H124 R131 D133 L134 S136 Y137 R208

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
PDBsum	4v9k
PubMed	23812722
UniProt	P62664\|RS4_THET2 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]