Structure of PDB 4v8k Chain AD

Receptor sequence
>4v8kAD (length=57) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
NANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPVS
YQALGKK
3D structure
PDB4v8k Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
ChainAD
Resolution3.006 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CRT AD L21 I24 L31 I35 I38 L17 I20 L27 I31 I34
BS02 CRT AD L33 H36 L29 H32
BS03 CA AD W46 L47 D48 D49 N50 I51 W42 L43 D44 D45 N46 I47
BS04 BCL AD Q28 I29 H36 W46 L47 Q24 I25 H32 W42 L43
BS05 BCL AD Q28 L31 G32 I35 H36 Q24 L27 G28 I31 H32
BS06 CRT AD K10 I11 K6 I7
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8k, PDBe:4v8k, PDBj:4v8k
PDBsum4v8k
PubMed24670637
UniProtD2Z0P2

[Back to BioLiP]