Structure of PDB 4v82 Chain AD

Receptor sequence

>4v82AD (length=341) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTH
GLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLW
TFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYP
LGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLC
AIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAF
SNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

4v82 Structural basis of cyanobacterial photosystem II Inhibition by the herbicide terbutryn

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	AD	H214 H268	H203 H257
BS02	BCT	AD	Y244 H268	Y233 H257
BS03	CLA	AD	M198 V201 A202 G206	M187 V190 A191 G195
BS04	CLA	AD	F157 I178 L182	F146 I167 L171
BS05	CLA	AD	F120 I123 M126 L127 F130	F109 I112 M115 L116 F119
BS06	CLA	AD	L45 V152 F153 V156 L182 F185 Q186 W191 T192 H197 V201 V204 L279 S282 A283	L34 V141 F142 V145 L171 F174 Q175 W180 T181 H186 V190 V193 L268 S271 A272
BS07	PHO	AD	L209 I213 W253 F257	L198 I202 W242 F246
BS08	PHO	AD	A41 L45 W48 G118 F125 N142 F146 P149 F153 G174 P275 L279	A30 L34 W37 G107 F114 N131 F135 P138 F142 G163 P264 L268
BS09	CLA	AD	L36 P39 C40 L43 L90 L91 L92 W93 F113 H117	L25 P28 C29 L32 L79 L80 L81 W82 F102 H106

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v82, PDBe:4v82, PDBj:4v82
PDBsum	4v82
PubMed	21367867
UniProt	Q8CM25\|PSBD_THEVB Photosystem II D2 protein (Gene Name=psbD1)

[Back to BioLiP]