Structure of PDB 4v7h Chain AD

Receptor sequence
>4v7hAD (length=124) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence]
RTYSKTYSTPKRPYESARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSED
KKKLDYVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQ
IVNIPSFMVRLDSEKHIDFAPTSP
3D structure
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
ChainAD
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AD R6 T7 Y8 K10 T11 K16 R17 R57 R62 L76 I77 R78 R79 R82 L86 R108 Q110 Y114 K120 S121 V122 H123 H124 R126 V127 Q131 R132 R1 T2 Y3 K5 T6 K11 R12 R18 R23 L37 I38 R39 R40 R43 L47 R69 Q71 Y75 K81 S82 V83 H84 H85 R87 V88 Q92 R93
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Nov 26 22:53:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7h', asym_id = 'AD', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7h', asym_id='AD', title='Comprehensive molecular structure of the eukaryotic ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0006412,0015935,0019843', uniprot = '', pdbid = '4v7h', asym_id = 'AD'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015935,0019843', uniprot='', pdbid='4v7h', asym_id='AD')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>