Structure of PDB 4v65 Chain AD

Receptor sequence

>4v65AD (length=123) Species: 562 (Escherichia coli) [Search protein sequence]

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA

3D structure

PDB

4v65 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading

Chain

Resolution

9.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	V36 T38 T39 P41 K43 N45 A47 K50 H71 N72 Q74 E75 H76	V36 T38 T39 P41 K43 N45 A47 K50 H71 N72 Q74 E75 H76
BS02	rna	AD	V3 Q5 L6 R8 K9 P10 R11 A12 R13 K14 A16 K17 N19 V20 P21 E24 P27 Q28 R30 K42 R49 R55 T57 N58 G59 E61 Y65 R82 V86 K87 D88 G91 R93 R109 Q111 R113 S114 G117 V118 K119 R120	V3 Q5 L6 R8 K9 P10 R11 A12 R13 K14 A16 K17 N19 V20 P21 E24 P27 Q28 R30 K42 R49 R55 T57 N58 G59 E61 Y65 R82 V86 K87 D88 G91 R93 R109 Q111 R113 S114 G117 V118 K119 R120

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0034336	misfolded RNA binding

	Biological Process
GO:0000372	Group I intron splicing
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033120	positive regulation of RNA splicing
GO:0034337	RNA folding
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v65, PDBe:4v65, PDBj:4v65
PDBsum	4v65
PubMed
UniProt	P0A7S3\|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)