Structure of PDB 4v4w Chain AD

Receptor sequence
>4v4wAD (length=204) Species: 562 (Escherichia coli) [Search protein sequence]
RYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDYG
VQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNVV
YRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQ
SRVKAALELAEQREKPTWLEVDAGKMEGTFKRKPERSDLSADINEHLIVE
LYSK
3D structure
PDB4v4w Elongation arrest by SecM via a cascade of ribosomal RNA rearrangements
ChainAD
Resolution15.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AD L4 G5 K9 R12 K21 I27 K32 I33 Q35 P37 G38 Q39 H40 R43 H119 L3 G4 K8 R11 K20 I26 K31 I32 Q34 P36 G37 Q38 H39 R42 H118
Gene Ontology
Molecular Function
GO:0000900 mRNA regulatory element binding translation repressor activity
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006353 DNA-templated transcription termination
GO:0006412 translation
GO:0006417 regulation of translation
GO:0031564 transcription antitermination
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
GO:0045947 negative regulation of translational initiation
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4w, PDBe:4v4w, PDBj:4v4w
PDBsum4v4w
PubMed16713583
UniProtP0A7V8|RS4_ECOLI Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]