Structure of PDB 4v4r Chain AD

Receptor sequence

>4v4rAD (length=208) Species: 300852 (Thermus thermophilus HB8)

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

• PDB: 4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
• Chain: AD
• Resolution: 5.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	G2 R3 Y4 I5 C9 R10 R13 R14 K22 E24 R25 A32 R35 R36 Y38 P40 G41 Q42 H43 Q45 R49 Y54 Q62 R65 S71 E72 R73 Q74 S113 R115 Q116 R118 Q119 R122 H123 R132 D134 L135 S137 S208 R209	G1 R2 Y3 I4 C8 R9 R12 R13 K21 E23 R24 A31 R34 R35 Y37 P39 G40 Q41 H42 Q44 R48 Y53 Q61 R64 S70 E71 R72 Q73 S112 R114 Q115 R117 Q118 R121 H122 R131 D133 L134 S136 S207 R208

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
• PDBsum: 4v4r
• PubMed: 16377566
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)