Structure of PDB 4v4p Chain AD

Receptor sequence

>4v4pAD (length=173) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

QYRIIDFKRDKDGIPGRVATIEYDPNRSANIALINYADGEKRYIIAPKNL
KVGMEIMSGPDADIKIGNALPLENIPVGTLVHNIELKPGRGGQLVRAAGT
SAQVLGKEGKYVIVRLASGEVRMILGKCRATVGEVGNGGRTDKPFVKAGN
KHHKMKAPNVRGVAMNAVDHPFG

3D structure

PDB

4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.

Chain

Resolution

5.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AD	Q60 I63 F66 D69 Y82 D83 P84 R86 A96 D97 G98 K146 P147 G148 R149 G151 Q152 L153 V154 R155 A157 G158 L175 S177 L184 N196 G198 T200 F204 K206 A207 K210 H211 H212 V224 R225 G226 V227 M229 N230 V232 D233 H234 P235	Q1 I4 F7 D10 Y23 D24 P25 R27 A37 D38 G39 K87 P88 G89 R90 G92 Q93 L94 V95 R96 A98 G99 L116 S118 L125 N137 G139 T141 F145 K147 A148 K151 H152 H153 V160 R161 G162 V163 M165 N166 V168 D169 H170 P171

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v4p, PDBe:4v4p, PDBj:4v4p
PDBsum	4v4p
PubMed	15802605
UniProt	P60405\|RL2_THET8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]