Structure of PDB 8oeq Chain AC

Receptor sequence

>8oeqAC (length=62) Species: 5476 (Candida albicans)

AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDAKFKRNHRYALHGTA
KALAKARAEKSA

3D structure

• PDB: 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: AC
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AC	K3 S4 K5 N6 H7 T8 A9 H10 N11 Q12 T13 K15 H17 R18 N19 K25 T26 Y27 K28 Y29 P30 S31 L32 K33 D36 A37 F39 R41 N42 H43 Y45 A46 L47 T50 L54	K2 S3 K4 N5 H6 T7 A8 H9 N10 Q11 T12 K14 H16 R17 N18 K24 T25 Y26 K27 Y28 P29 S30 L31 K32 D35 A36 F38 R40 N41 H42 Y44 A45 L46 T49 L53

External links

• PDB: RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
• PDBsum: 8oeq
• UniProt: A0A8H6F0G8