Structure of PDB 7wfd Chain AC

Receptor sequence
>7wfdAC (length=80) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGC
KRCESACPTDFLSVRVYLWHETTRSMGLAY
3D structure
PDB7wfd Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
ChainAC
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.97.1.12: photosystem I.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 AC C21 P22 T23 V25 L26 C48 G50 C51 K52 R53 C54 V67 C20 P21 T22 V24 L25 C47 G49 C50 K51 R52 C53 V66
BS02 SF4 AC C11 I12 C14 T15 Q16 C17 M28 C58 P59 S64 V65 C10 I11 C13 T14 Q15 C16 M27 C57 P58 S63 V64
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009533 chloroplast stromal thylakoid
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wfd, PDBe:7wfd, PDBj:7wfd
PDBsum7wfd
PubMed35123031
UniProtP62090|PSAC_ARATH Photosystem I iron-sulfur center (Gene Name=psaC)

[Back to BioLiP]