Structure of PDB 6olz Chain AC

Receptor sequence

>6olzAC (length=363) Species: 9606 (Homo sapiens) [Search protein sequence]

CARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPY
AVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMF
APTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPL
VVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRI
QRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIW
TESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRAL
RAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVD
KAAAAAAALQAKS

3D structure

PDB

6olz Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AC	A53 V54 K195 M196	A51 V52 K193 M194
BS02	rna	AC	R33 I36 F39 T42 R45 K46 N47 N48 R49 Q50 Y52 A53 A58 H60 S63 T69 R71 A72 V73 A74 R75 I76 P77 R80 T84 H85 R86 Q89 N94 M95 C96 R97 R100 M101 F102 A103 P104 W108 R109 R110 R113 R114 N116 T117 T118 Q119 K120 R121 K140 R143 K163 T164 K172 K182 R188 M189 R190 A191 G192 K193 M196 R197 R199 R200 R201 R204 R205 K219 R222 N223 K234 L235 N236 K239 P242 G243 H245 R268 K274 S275 D288 R300 R303 P305 R306 K307 R311 R312 L314 K316 N321 L322 R323 I324 K327 T339 R342 Q343 H347 R350	R31 I34 F37 T40 R43 K44 N45 N46 R47 Q48 Y50 A51 A56 H58 S61 T67 R69 A70 V71 A72 R73 I74 P75 R78 T82 H83 R84 Q87 N92 M93 C94 R95 R98 M99 F100 A101 P102 W106 R107 R108 R111 R112 N114 T115 T116 Q117 K118 R119 K138 R141 K161 T162 K170 K180 R186 M187 R188 A189 G190 K191 M194 R195 R197 R198 R199 R202 R203 K217 R220 N221 K232 L233 N234 K237 P240 G241 H243 R266 K272 S273 D286 R298 R301 P303 R304 K305 R309 R310 L312 K314 N319 L320 R321 I322 K325 T337 R340 Q341 H345 R348
BS03	peptide	AC	R71 G83	R69 G81

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6olz, PDBe:6olz, PDBj:6olz
PDBsum	6olz
PubMed	31160784
UniProt	P36578\|RL4_HUMAN Large ribosomal subunit protein uL4 (Gene Name=RPL4)

[Back to BioLiP]