Structure of PDB 5jus Chain AC

Receptor sequence
>5jusAC (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ENVWFSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFN
KFR
3D structure
PDB5jus Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
ChainAC
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AC W7 F8 S9 H10 P11 R13 Y14 K16 R19 C24 G29 L30 I31 R32 K33 Y34 R40 Q41 R44 K54 F55 R56 W4 F5 S6 H7 P8 R10 Y11 K13 R16 C21 G26 L27 I28 R29 K30 Y31 R37 Q38 R41 K51 F52 R53
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jus, PDBe:5jus, PDBj:5jus
PDBsum5jus
PubMed27159452
UniProtP41057|RS29A_YEAST Small ribosomal subunit protein uS14A (Gene Name=RPS29A)

[Back to BioLiP]