Structure of PDB 5b5m Chain AC

Receptor sequence
>5b5mAC (length=60) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
FTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNI
PVSYQALGKK
3D structure
PDB5b5m Structural Basis for the Unusual Qy Red-Shift and Enhanced Thermostability of the LH1 Complex from Thermochromatium tepidum.
ChainAC
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRT AC L33 H36 M37 L32 H35 M36
BS02 BCL AC Q28 L31 G32 I35 H36 Q27 L30 G31 I34 H35
BS03 BCL AC Q28 I29 H36 W46 Q27 I28 H35 W45
BS04 CRT AC I24 F27 Q28 I23 F26 Q27
BS05 BCL AC V20 S23 V19 S22
BS06 CRT AC I11 I14 I10 I13
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b5m, PDBe:5b5m, PDBj:5b5m
PDBsum5b5m
PubMed27933779
UniProtD2Z0P2

[Back to BioLiP]