Structure of PDB 5aj0 Chain AC

Receptor sequence

>5aj0AC (length=363) Species: 9606 (Homo sapiens) [Search protein sequence]

CARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPY
AVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMF
APTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPL
VVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRI
QRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIW
TESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRAL
RAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVD
KAAAAAAALQAKS

3D structure

PDB

5aj0 Structural Snapshots of Actively Translating Human Ribosomes

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AC	P51 Y52 V54 E56 T107 K195 M196	P49 Y50 V52 E54 T105 K193 M194
BS02	rna	AC	C3 A4 P6 R33 I36 F39 T42 R45 K46 N47 N48 R49 Q50 Y52 A53 S55 G59 T62 S63 T69 A72 V73 A74 R75 I76 P77 R80 G82 G83 T84 R86 Q89 M95 R97 G98 R100 M101 F102 A103 P104 K106 R109 R110 R113 R114 N116 T118 Q119 K120 G141 R143 K163 T164 L169 K172 N178 K182 R188 R190 A191 G192 K193 K195 M196 R197 R199 R204 R205 I218 K219 R222 N223 K234 L235 N236 K239 P242 G243 H245 K274 L293 I309 H310 R311 R312 L314 K316 K320 N321 L322 R323 K327 M335 R336 T339 Q343 N346 H347 R350	C1 A2 P4 R31 I34 F37 T40 R43 K44 N45 N46 R47 Q48 Y50 A51 S53 G57 T60 S61 T67 A70 V71 A72 R73 I74 P75 R78 G80 G81 T82 R84 Q87 M93 R95 G96 R98 M99 F100 A101 P102 K104 R107 R108 R111 R112 N114 T116 Q117 K118 G139 R141 K161 T162 L167 K170 N176 K180 R186 R188 A189 G190 K191 K193 M194 R195 R197 R202 R203 I216 K217 R220 N221 K232 L233 N234 K237 P240 G241 H243 K272 L291 I307 H308 R309 R310 L312 K314 K318 N319 L320 R321 K325 M333 R334 T337 Q341 N344 H345 R348

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0070062	extracellular exosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5aj0, PDBe:5aj0, PDBj:5aj0
PDBsum	5aj0
PubMed	25957688
UniProt	P36578\|RL4_HUMAN Large ribosomal subunit protein uL4 (Gene Name=RPL4)

[Back to BioLiP]