Structure of PDB 4v7k Chain AC

Receptor sequence
>4v7kAC (length=120) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGID
PRRSDQNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTF
LRSVYVTTTMGPSVRINPHS
3D structure
PDB4v7k The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
ChainAC
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AC K3 H4 G5 K6 R7 Y8 R9 K37 F38 T41 E43 H45 K47 D167 K168 T169 H173 P175 K206 S212 Y214 T216 T218 M219 S222 K2 H3 G4 K5 R6 Y7 R8 K36 F37 T40 E42 H44 K46 D58 K59 T60 H64 P66 K97 S103 Y105 T107 T109 M110 S113
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7k, PDBe:4v7k, PDBj:4v7k
PDBsum4v7k
PubMed20005802
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]