Structure of PDB 4v6u Chain AC

Receptor sequence
>4v6uAC (length=186) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
MAIERYFIREAVREMLIDEFLEKELRRAGYGGLDIKKTPLGTKVIIFAAN
PGYVIGRGGRRIRELTRILEKQFGLENPQIEVEEIKNPYLNAKVQAVRLA
QALERGIHFRRAAYAALRAIMNNGARGVEIRLSGKLTGERAKSIRFYQGY
LAKVGNPAETLVSKGYAQALLKLGVIGVKVAIMPPG
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainAC
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AC M1 A2 R5 S133 E139 R140 K142 R145 Y147 Y150 L151 A152 K153 V154 G155 N156 P157 Y166 Q168 L170 K172 L173 G174 V175 G177 K179 M1 A2 R5 S133 E139 R140 K142 R145 Y147 Y150 L151 A152 K153 V154 G155 N156 P157 Y166 Q168 L170 K172 L173 G174 V175 G177 K179
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U004|RS3_PYRFU Small ribosomal subunit protein uS3 (Gene Name=rps3)

[Back to BioLiP]