Structure of PDB 8iuf Chain AB

Receptor sequence

>8iufAB (length=88) Species: 3039 (Euglena gracilis)

LDSAIHFLDREDVTKRVLKIVAAFDKVTKEVKADSHFVNDLGLDSLDVVE
VVMSLEQEFNVDMSNQDAEKIHTVKDAIDYFCAHPASM

3D structure

• PDB: 8iuf Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism.
• Chain: AB
• Resolution: 2.81 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZMP	AB	S91 L92	S45 L46

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 05:10:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8iuf', asym_id = 'AB', title = "Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. "

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8iuf', asym_id='AB', title="Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. ")

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006633', uniprot = '', pdbid = '8iuf', asym_id = 'AB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006633', uniprot='', pdbid='8iuf', asym_id='AB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>