Structure of PDB 8evs Chain AB

Receptor sequence

>8evsAB (length=386) Species: 4932 (Saccharomyces cerevisiae)

SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKA
GMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARI
KKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEK
TVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVAC
IGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRT
KKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKAL
EEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL

3D structure

• PDB: 8evs Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: AB
• Resolution: 2.62 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AB	S2 H3 R4 K5 E7 A8 P9 R10 H11 G12 H13 L14 G15 F16 L17 P18 R19 K20 R21 I25 R26 R28 K30 A31 K50 M53 T54 T55 R62 P63 S65 A75 Y92 T95 P96 R97 L99 R100 S101 L102 T103 T104 W106 R116 R117 F118 Y119 K120 N121 Y123 K124 S125 K126 K128 A129 F130 K132 Y133 Y154 R159 A172 Q173 K174 K175 L178 E180 T221 K222 G223 H224 G225 F226 G228 H231 R232 K236 K237 R240 K241 T242 H243 R244 G245 L246 R247 K248 A250 C251 I252 G253 A254 W255 H256 P257 A258 H259 V260 W262 S263 R266 A267 Q269 R270 Y272 S274 R275 T276 N279 H280 M308 G309 H313 G315 C327 I328 P329 G330 N331 R332 K333 R334 Y343 R348 K349 S363 K364 F365 G366 K367 R369 K376 M380 L383 K384 K385	S1 H2 R3 K4 E6 A7 P8 R9 H10 G11 H12 L13 G14 F15 L16 P17 R18 K19 R20 I24 R25 R27 K29 A30 K49 M52 T53 T54 R61 P62 S64 A74 Y91 T94 P95 R96 L98 R99 S100 L101 T102 T103 W105 R115 R116 F117 Y118 K119 N120 Y122 K123 S124 K125 K127 A128 F129 K131 Y132 Y153 R158 A171 Q172 K173 K174 L177 E179 T220 K221 G222 H223 G224 F225 G227 H230 R231 K235 K236 R239 K240 T241 H242 R243 G244 L245 R246 K247 A249 C250 I251 G252 A253 W254 H255 P256 A257 H258 V259 W261 S262 R265 A266 Q268 R269 Y271 S273 R274 T275 N278 H279 M307 G308 H312 G314 C326 I327 P328 G329 N330 R331 K332 R333 Y342 R347 K348 S362 K363 F364 G365 K366 R368 K375 M379 L382 K383 K384

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0006414 translational elongation
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8evs, PDBe:8evs, PDBj:8evs
• PDBsum: 8evs
• PubMed: 37595043
• UniProt: P14126|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)