Structure of PDB 8e73 Chain AB |
>8e73AB (length=85) Species: 157791 (Vigna radiata) [Search protein sequence] |
RGSFLDKSEVADRVISCVKNFQKVDPAKVTPNAHFQNDLGLDSLDAVEIV MALEEEFGFEIPDNEADKINSIKHAVDFIASHPQA |
|
PDB | 8e73 Plant-specific features of respiratory supercomplex I + III 2 from Vigna radiata. |
Chain | AB |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZMP |
AB |
S85 L86 |
S43 L44 |
|
|
|
|