Structure of PDB 8c3a Chain AB

Receptor sequence

>8c3aAB (length=148) Species: 5476 (Candida albicans)

PTRLTKTRKHRGNVSAGKGRIGKHRKHPGGRGKAGGQHHHRTNLDKYHPG
YFGKVGMRYFHKQQNHFWRPEINLDKLWTLVDSEKKDEYLSKSSASAAPV
IDTLAHGYGKVLGKGRLPEVPVIVKARFVSKLAEEKIRAVGGVVELVA

3D structure

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Chain: AB
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AB	P2 T3 R4 T6 K7 T8 R9 K10 H11 R12 G13 N14 V15 G18 K19 G20 R21 I22 G23 K24 H25 R26 K27 H28 P29 G30 G31 R32 G33 K34 G36 H39 H40 H41 R42 T43 N44 Y48 Y52 F53 G54 K55 V56 G57 M58 R59 Y60 F61 H62 K63 Q64 N66 H67 R70 E72 N74 K111 L113 G114 K115 G116 R117 S131 K132 L133	P1 T2 R3 T5 K6 T7 R8 K9 H10 R11 G12 N13 V14 G17 K18 G19 R20 I21 G22 K23 H24 R25 K26 H27 P28 G29 G30 R31 G32 K33 G35 H38 H39 H40 R41 T42 N43 Y47 Y51 F52 G53 K54 V55 G56 M57 R58 Y59 F60 H61 K62 Q63 N65 H66 R69 E71 N73 K110 L112 G113 K114 G115 R116 S130 K131 L132
BS02	MG	AB	N14 S16	N13 S15

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: A0A8H6BVY8