Structure of PDB 8a22 Chain AB

Receptor sequence

>8a22AB (length=50) Species: 353565 (Polytomella magna)

MKRGMTYQPSRKKRINKHGMEKRLGTEDGRLTILRRLEKGRWRLTVDMFR

3D structure

• PDB: 8a22 Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
• Chain: AB
• Resolution: 2.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AB	Y120 R127 H131 R136 R148 R149 K152 G153 R154 W155	Y7 R14 H18 R23 R35 R36 K39 G40 R41 W42
BS02	rna	AB	M114 K115 R116 G117 T119 Q121 S123 K126 R127 K130 H131	M1 K2 R3 G4 T6 Q8 S10 K13 R14 K17 H18
BS03	rna	AB	M114 R116	M1 R3

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 23:57:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8a22', asym_id = 'AB', title = 'Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8a22', asym_id='AB', title='Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8a22', asym_id = 'AB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8a22', asym_id='AB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>