Structure of PDB 6vu3 Chain AB |
>6vu3AB (length=98) Species: 562 (Escherichia coli) [Search protein sequence] |
KKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEKFFPGYV LVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQ |
|
PDB | 6vu3 Structural basis of transcription-translation coupling. |
Chain | AB |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
AB |
S16 P66 |
S11 P47 |
|
|
|
|