Structure of PDB 6qa9 Chain AB

Receptor sequence

>6qa9AB (length=87) Species: 9940 (Ovis aries)

DAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEII
MAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

3D structure

• PDB: 6qa9 Structures of Respiratory Supercomplex I+III2Reveal Functional and Conformational Crosstalk.
• Chain: AB
• Resolution: 4.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D43
• Catalytic site (residue number reindexed from 1): D42

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZMP	AB	D43 S44	D42 S43

Gene Ontology

Biological Process

• GO:0006633 fatty acid biosynthetic process

External links

• PDB: RCSB:6qa9, PDBe:6qa9, PDBj:6qa9
• PDBsum: 6qa9
• PubMed: 31492636
• UniProt: W5NQT7