Structure of PDB 4v6x Chain AB

Receptor sequence
>4v6xAB (length=215) Species: 9606 (Homo sapiens) [Search protein sequence]
KKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFE
VSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQ
TMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKM
MEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKML
KKPKFELGKLMELHG
3D structure
PDB4v6x Structures of the human and Drosophila 80S ribosome.
ChainAB
Resolution5.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AB V114 K115 K116 W117 Q118 M120 H124 R136 R146 N148 Q149 I150 R151 Y155 Q157 H158 Q159 S203 I204 Y205 P206 K214 K216 V96 K97 K98 W99 Q100 M102 H106 R118 R128 N130 Q131 I132 R133 Y137 Q139 H140 Q141 S185 I186 Y187 P188 K196 K198
BS02 rna AB E224 G226 E206 G208
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006413 translational initiation
GO:0030154 cell differentiation
GO:0042274 ribosomal small subunit biogenesis
GO:0043066 negative regulation of apoptotic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6x, PDBe:4v6x, PDBj:4v6x
PDBsum4v6x
PubMed23636399
UniProtP61247|RS3A_HUMAN Small ribosomal subunit protein eS1 (Gene Name=RPS3A)

[Back to BioLiP]