Structure of PDB 4v49 Chain AB

Receptor sequence

>4v49AB (length=234) Species: 562 (Escherichia coli)

VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFR
FIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFK
TISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLK
RLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDD
AIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQ

3D structure

• PDB: 4v49 X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli
• Chain: AB
• Resolution: 8.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AB	K22 W24 P26 G99 T103 N104 K133 I172 E176 K179	K16 W18 P20 G93 T97 N98 K127 I166 E170 K173

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:18:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v49', asym_id = 'AB', title = 'X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v49', asym_id='AB', title='X-ray Crystal Structures of the WT and a Hyper-Accurate Ribosome From Escherichia Coli')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v49', asym_id = 'AB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015935', uniprot='', pdbid='4v49', asym_id='AB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>