Structure of PDB 8q3x Chain AAA

Receptor sequence
>8q3xAAA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8q3x Viral peptide conjugates for metal-warhead delivery to chromatin.
ChainAAA
Resolution2.301 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna AAA H39 Y41 R42 P43 T45 R63 R72 R83 F84 Q85 S86 R116 V117 T118 H2 Y4 R5 P6 T8 R26 R35 R46 F47 Q48 S49 R79 V80 T81
BS02 dna AAA R40 Y41 P43 G44 V46 R49 R63 K64 L65 R69 R3 Y4 P6 G7 V9 R12 R26 K27 L28 R32
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q3x, PDBe:8q3x, PDBj:8q3x
PDBsum8q3x
PubMed38495982
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]