Structure of PDB 8q36 Chain AAA

Receptor sequence
>8q36AAA (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB8q36 Viral peptide conjugates for metal-warhead delivery to chromatin.
ChainAAA
Resolution2.604 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna AAA H39 R42 P43 T45 R63 R72 R83 F84 S86 R116 V117 T118 H2 R5 P6 T8 R26 R35 R46 F47 S49 R79 V80 T81
BS02 dna AAA R40 Y41 P43 G44 T45 V46 R49 R63 L65 R69 R83 R3 Y4 P6 G7 T8 V9 R12 R26 L28 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8q36, PDBe:8q36, PDBj:8q36
PDBsum8q36
PubMed38495982
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]