Structure of PDB 8atj Chain AAA |
>8atjAAA (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] |
TKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLG VTRVGHRMNIERALKQLLDR |
|
PDB | 8atj Structural deficits in key domains of Shank2 lead to alterations in postsynaptic nanoclusters and to a neurodevelopmental disorder in humans. |
Chain | AAA |
Resolution | 2.117 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
AAA |
H1803 H1835 |
H24 H56 |
|
|
|