Structure of PDB 7r0d Chain AAA

Receptor sequence

>7r0dAAA (length=152) Species: 9606 (Homo sapiens)

GRRPGVGVGVVVTSCKHPRCVLLGKRKGSGSFQLPGGHLEFGETWEECAQ
RETWEEAALHLKNVHFASVVNSFIEKENYHYVTILMKGEVDVTHDSEPKN
VEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKG
NH

3D structure

• PDB: 7r0d Structure of NUDT15 in complex with Geranyl monophosphate
• Chain: AAA
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.9: nucleotide diphosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RDZ	AAA	G17 P46 G47 G48 H49	G9 P35 G36 G37 H38
BS02	MG	AAA	E63 E67	E52 E56

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008413 8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity
• GO:0016787 hydrolase activity
• GO:0035539 8-oxo-7,8-dihydrodeoxyguanosine triphosphate pyrophosphatase activity
• GO:0044715 8-oxo-dGDP phosphatase activity
• GO:0046872 metal ion binding
• GO:0047429 nucleoside triphosphate diphosphatase activity

Biological Process

• GO:0000278 mitotic cell cycle
• GO:0000302 response to reactive oxygen species
• GO:0006195 purine nucleotide catabolic process
• GO:0006203 dGTP catabolic process
• GO:0009217 purine deoxyribonucleoside triphosphate catabolic process
• GO:0042178 xenobiotic catabolic process
• GO:0042262 DNA protection
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0061136 regulation of proteasomal protein catabolic process
• GO:1901292 nucleoside phosphate catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:7r0d, PDBe:7r0d, PDBj:7r0d
• PDBsum: 7r0d
• PubMed: 38944687
• UniProt: Q9NV35|NUD15_HUMAN Nucleotide triphosphate diphosphatase NUDT15 (Gene Name=NUDT15)