Structure of PDB 7qwh Chain AAA

Receptor sequence

>7qwhAAA (length=124) Species: 9913 (Bos taurus)

KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES
LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT
QANKHIIVACEGNPYVPVHFDASV

3D structure

• PDB: 7qwh Interaction of VIVO-8-hydroxyquinoline species with RNase A: the effect of metal ligands in the protein adduct stabilization
• Chain: AAA
• Resolution: 1.573 Å

Enzymatic activity

• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	I3Y	AAA	C65 N67 Q69 N71 A109 E111 V118 H119	C65 N67 Q69 N71 A109 E111 V118 H119

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0016829 lyase activity

Biological Process

• GO:0050830 defense response to Gram-positive bacterium

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:7qwh, PDBe:7qwh, PDBj:7qwh
• PDBsum: 7qwh
• UniProt: P61823|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)