Structure of PDB 7qf9 Chain AAA

Receptor sequence
>7qf9AAA (length=147) Species: 9606 (Homo sapiens) [Search protein sequence]
KDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKI
LKCKAVSRELNFSSTEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTN
TWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRLFYV
3D structure
PDB7qf9 Stabilization of the RAS:PDE6D Complex Is a Novel Strategy to Inhibit RAS Signaling.
ChainAAA
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide AAA I53 L54 V59 L87 E88 W90 L108 I109 E110 A111 A112 Q116 M117 M118 Y149 I50 L51 V56 L84 E85 W87 L105 I106 E107 A108 A109 Q113 M114 M115 Y146
BS02 FAR AAA M20 Q78 I129 L147 M17 Q75 I126 L144
Gene Ontology
Molecular Function
GO:0005095 GTPase inhibitor activity
GO:0005515 protein binding
GO:0031267 small GTPase binding
Biological Process
GO:0007601 visual perception
GO:0050953 sensory perception of light stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qf9, PDBe:7qf9, PDBj:7qf9
PDBsum7qf9
PubMed35104933
UniProtO43924|PDE6D_HUMAN Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta (Gene Name=PDE6D)

[Back to BioLiP]