Structure of PDB 7o5v Chain AAA

Receptor sequence
>7o5vAAA (length=250) Species: 392499 (Rhizorhabdus wittichii RW1) [Search protein sequence]
HNKVRTCWNEGRPALAGWLQLPGTLHAEALARLDYDAVVIDMQASPIDFG
QVAPMLIAIELGGAEPFVRTQVNDPSDIMKLLDAGAYGIIAPMVNTRAEA
QTLASALHYSPRGLRSFGPRRPSLRYGSGYLAQASETVVGLAMIETREAL
ANIDEILSVDGIDGVFIGPTDLALDLGHAPLVDTEEAEVVSAIAHVRERA
HAAGKRVGIFCGSGGFARVKLAEGFDFVTAAPDLAMLSAAARQVIADARA
3D structure
PDB7o5v Substrate Induced Movement of the Metal Cofactor between Active and Resting State.
ChainAAA
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG AAA E145 D171 E145 D171
BS02 3PY AAA R69 M143 E145 G168 P169 T170 D171 F210 R69 M143 E145 G168 P169 T170 D171 F210
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 05:48:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7o5v', asym_id = 'AAA', title = 'Substrate Induced Movement of the Metal Cofactor between Active and Resting State.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7o5v', asym_id='AAA', title='Substrate Induced Movement of the Metal Cofactor between Active and Resting State.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003824', uniprot = '', pdbid = '7o5v', asym_id = 'AAA'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824', uniprot='', pdbid='7o5v', asym_id='AAA')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>