Structure of PDB 7nm8 Chain AAA

Receptor sequence

>7nm8AAA (length=251) Species: 1888 (Streptomyces albus)

TQRHQGRTALVTGGSRGIGRAISRRLAAEGALVAVHYGHDHAAAERTVKE
IETDGGRAFPVHAELGVEGDAATLWAAFDEALSGTGSGPGLDILVNNAGI
TLPRPIAAVTEAEYDRVFAVNTRAPFFIVQRSLERLRDGGRIISISSAAT
QTAYPAIVAYSMSKGALDVLTPALAKQLGPRGITVNTVAPGFTETEILSN
PEIRKALSSASVFGRLGAPADIADVVSFVASDEARWVTGQWIDATGGVGL
G

3D structure

• PDB: 7nm8 A Standalone beta-Ketoreductase Acts Concomitantly with Biosynthesis of the Antimycin Scaffold.
• Chain: AAA
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	AAA	G44 S46 R47 G48 I49 H67 Y68 G69 H70 L96 N128 G130 S178 Y191 K195 G222 T224 T226	G13 S15 R16 G17 I18 H36 Y37 G38 H39 L65 N97 G99 S147 Y160 K164 G191 T193 T195

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 02:51:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nm8', asym_id = 'AAA', title = 'A Standalone beta-Ketoreductase Acts Concomitantly with Biosynthesis of the Antimycin Scaffold.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nm8', asym_id='AAA', title='A Standalone beta-Ketoreductase Acts Concomitantly with Biosynthesis of the Antimycin Scaffold.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '7nm8', asym_id = 'AAA'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='7nm8', asym_id='AAA')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>